UNIVERSIDAD AUTONOMA DE CHIAPAS FACULTAD DE CIENCIAS QUIMICAS

UNIVERSIDAD AUTONOMA DE CHIAPAS FACULTAD DE CIENCIAS QUIMICAS EXTENSION OCOZOCOAUTLA BIOQUIMICA COUTIÑO DIANA DOMINGUEZ ZULEIMA PEREZ FLORINDA RUIZ VALERIA

LIPASA ENZYMA: 3. 1. 1. 3

Información General Ubicación: Páncreas, Boca, Estómago. Pertenece a la clase Hidrolasa y actúa sobre los enlaces éster Enzimas [BR: ko 01000] Nombre Sistemático: 3. 1. 1. 3 3. Hidrolasas 3. 1 Actúan sobre los enlaces éster 3. 1. 1 hidrolasas carboxílicos-éster 3. 1. 1. 3 triacilglicerol lipasa

Varios tipos diferentes de las lipasas se encuentran en el cuerpo humano (Tabla 1 y 2). Tabla 1. Tipos de lipasas presentes en el Homo Sapiens Tipos de Enzima Ubicación Función Sales biliares lipasa Glándulas mamarias Ayuda a la digestión de grasas Lipasa Pancreática Páncreas descompone los triglicéridos Lipasa Lisosomal Orgánulos Lipasa Hepática endotelio modula el metabolismo de lipoproteínas y la aterosclerosis Tabla 1. Distribución de los tipos de enzima localizadas en el cuerpo humano. Fuente: (Hanz, 2014)

Tabla 2. Homólogos de la lipasa en el Homo Sapiens. Fuente (Kegg, 2014)

Estructura a) b) Fig. 1. Estructura de la lipasa. a) Frontal, b) derecho (PDB, 2014)

a) b) Fig. 2 -Estructura de la lipasa pancreática. a)Estructura del complejo de lipasa-colipasa (3. 04 A), b)Interface de la activación lipasa-procolipasa, complejo de dos mezclas, reflejado por cristalografía de rayos X (3. 04 A) (Genoma. Net, 2014).

Fig. 1 -subunidades LIPI de humanos (Holmes & Cox, 2012). MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWYNNVI NPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC Secuencia Proteíca de la enzima Lipasa pancreática en: Homo Sapiens. AA: 465, PM: 45238 (KEGG, 2014)

Secuencia genómica atgctgccactttggactctttcactgctgctgggagcagtagcaggaaaagaagtttgctacgaaagactcggctgcttc agtgatgactccccatggtcaggaattacggaaagacccctccatatattgccttggtctccaaaagatgtcaacacccg cttcctcctatatactaatgagaacccaaacaactttcaagaagttgccgcagattcatcaagcatcagtggctccaatttc aaaacaaatagaaaaactcgctttattattcatggattcatagacaagggagaagaaaactggccaatgtgtgca agaatctgttcaaggtggaaagtgtgaactgtatctgtgtggactggaaaggtggctcccgaactggatacacacaagc ctcgcagaacatcaggatcgtgggagcagaagtggcatattttgttgaatttcttcagtcggcgttcggttactcaccttcca acgtgcatgtcattggccacagcctgggtgcccacgctgctggggaggctggaaggagaaccaatgggaccattgga cgcatcacagggttggacccagcagaaccttgctttcagggcacacctgaattagtccgattggaccccagcgatgcca aatttgtggatgtaattcacacggatggtgcccccatagtccccaatttggggtttggaatgagccaagtcgtgggccacct agatttccaaatggaggagtggaaatgcctggatgtaaaaagaacattctcagattgtggacatagacggaat ctgggaagggactcgagactttgcggcctgtaatcacttaagaagctacaaatattacactgatagcatcgtcaaccctg atggctttgctggattcccctgtgcctcttacaacgtcttcactgcaaacaagtgtttcccttgtccaagtggaggctgcccac agatgggtcactatgctgatatcctgggaaaacaaatgatgtgggccagaaattttatctagacactggtgatgcc agtaattttgcacgttggaggtataaggtatctgtcacactgtctggaaaaaaggttacaggacacatactagtttctttgttc ggaaataaaggaaactctaagcagtatgaaattttcaagggcactctcaaaccagatagtactcattccaatgaatttga ctcagatgtggatgttggggacttgcagatggttaaatttggtataacaatgtgatcaacccaactttacctagagtgg gagcatccaagattatagtggagacaaatgttggaaaacagttcaacttctgtagtccagaaaccgtcagggaggaag ttctgctcaccctcacaccgtgttag Secuencia Genómica de la enzima Lipasa Pancreática en: Homo Sapiens (KEGG, 2014)

Sitio activo de la lipasa • El sitio activo de la lipasa pancreática se localiza en la triada: • Ser-152 • His-263 • Asp-176 Acceso al sitio catalítico de las lipasas C) estructura cerrada D)estructura abierta • Vista de arriba de la lipas de Mucor miehei • En rojo zonas polares y en azul zonas hidrofóbicas • En amarillo sitio activo (UNAM, 2014)

Cofactor La actividad enzimática de la lipasa pancreática aumenta en gran medida cuando ésta forma un complejo con la colipasa pancreática, una proteína que forma un complejo con la lipasa (Fig. 3). Fig. 3 - Mecanismo de activación de interfaz de la triacilglicerol lipasa en complejo con la procolipasa (Voet & Voet, 2006).

Sustratos • Triacilglicerol Productos • Diacilglicerol • agua • Carboxilato

Reacción •

p. H y To Optima En el Ser Humano: p. H optimo: 6. 5 -7. 5 To Optima: 37° C inhibidor ü Orlistat ü Sales Biliares ü Taurodesoxicolato sodio

Mecanismo de Reaccion (Orlistat) Debido a su semejanza estructural con el triglicérido (Fig. 4) el fármaco se acopla al lugar activo de las enzimas mediante un enlace covalente con la serina. La fijación es reversible en condiciones fisiológica, el efecto inhibidor es inalterable durante el recorrido por el tubo digestivo (Fig. 5). Figura. 4. Estructura molécular del Orlistat (Brenda, 2014).

Figura 5. Mecanismo de acción del Orlistast (Xenical) en las lipasas gástricas y pancreáticas (Londoño, 2012).

REFERENCIAS types of lipasee. (2014). Recuperado el 31 de agosto de 2014, de types of lipase : http: //www. ehow. com/about_5750761_types-lipases. html BRENDA. (2014). BRENDA. Recuperado el 31 de agosto de 2014, de The Comprehensive Enzyme Information System: http: //www. brendaenzymes. org/php/result_flat. php 4? ecno=3. 1. 1. 3 Genomenet. (19 de agosto de 1994). PDB. Recuperado el 31 de agosto de 2014, de pdb: http: //www. genome. jp/dbget-bin/www_bget? pdb: 1 LPA Homo sapiens (Human). (2014). PDB. Recuperado el 31 de agosto de 2014, de PDB: http: //www. genome. jp/dbget-bin/pdb_list. cgi? hsa: 5406 National Library of Medicine. (2012). National Library of Medicine. Recuperado el 01 de agosto de 2014, de Medical Subject Headings: http: //www. nlm. nih. gov/cgi/mesh/2012/MB_cgi? mode=&term=Colipases PDB. (26 de agosto de 20114). RP 2 LIPASA. Recuperado el 31 de agosto de 2014, de RP 2 LIPASA: http: //www. rcsb. org/pdb/explore/jmol. do? structure. Id=1 GPL&bionumber=1 Revista Colombiana de Ciencias Químico - Farmacéuticas. (diciembre de 2012). Revista Colombiana de Ciencias Químico - Farmacéuticas. Recuperado el 31 de 09 de 2014, de ratamiento farmacológico contra la obesidad: http: //www. scielo. org. co/scielo. php? script=sci_arttext&pid=S 00347418201200007 UNAM. (2014). Intituto de Biotecnologia. Recuperado el 31 de agosto de 2014, de Intituto de Biotecnologia: http: //www. ibt. unam. mx/ Voet, & Voet. (2006). Bioquimica. España: Panamericana.

Maltasa ENZYMA: 3. 2. 1. 20

Es la enzima que cataliza la hidrólisis de la maltosa en glucosa La hidrólisis del terminal, no reductor (de 1> 4) residuos de alfa-D --glucosa con liberación de D-glucosa Enzymes [BR: ko 01000] 3. Hidrolasas 3. 2 Glicosilasas 3. 2. 1 Glicosidasas, enzimas que hidrolizan O- and S-componentes glicosilados 3. 2. 1. 20 alfa glucosidasa http: //www. genome. jp/kegg-bin/search_brite? option=-a&search_string=3. 2. 1. 20

Enzima Producido en Sitio de liberación Digestión de los carbohidratos Maltasa Intestino delgado

Tipos de maltasa • • Alfa glucosidasa Maltasa glucosidasa Alfa glucosidasa lisosomal Neutral alfa glucosidasa C http: //www. genome. jp/dbget-bin/www_bget? ec: 3. 2. 1. 20

Estructura

Secuencia genetica 1857 AA. 209852 MW

1857 AA. 209852 MW

1857 AA. 209852 MW

secuencia proteica 1857 AA. 209852 MW

Sitio activo • 529 1857 AA. 209852 MW http: //www. uniprot. org/blast/? about=P 10253[518]

• 532 1857 AA. 209852 MW

• 1420 1857 AA. 209852 MW

1423 1857 AA. 209852 MW

• 1426 1857 AA. http: //www. genome. jp/dbget-bin/www_bget? hsa: 8972

Funcion del grupo prosterico

Temperatura y p. H optimo TEMPERATUR ORGANISM UNIPROT E OPTIMUM ACCESSION MAXIMUM NO. 25 Homo sapiens 37 Homo sapiens - COMMENTAR Y additional information assay at room temperature - Homo sapiens - assay at http: //www. brenda-enzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword=&organism%5 B%5 D=Homo+sapiens&show_tm=0

p. H MAXIMUM OPTIMUM 3. 8 4 4 4. 5 5. 5 ORGANISM COMMENTARY Homo sapiens acid alpha-glucosidase assay at Homo sapiens hydrolysis of glycogen 4 -methylumbelliferyl-alphaglucoside 4 - Homo sapiens hydrolysis of glycogen or maltose, recombinant enzyme 4 4. 5 - Homo sapiens assay at hydrolysis of 4 -methylumbelliferyl alpha-glucoside - Homo sapiens Homo sapiens hydrolysis of maltose hydrolysis of maltotriitol and potato starch assay at neutral alpha-glucosidase assay at - Homo sapiens 5 4. 6 5 5. 6 6. 5 6. 8 7 7. 5 4 -methylumbelliferyl-alphaglucoside http: //www. brenda-enzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword=&organism%5 B%5 D=Homo+sapiens&show_tm=0

Funcion sustrato /producto SUBSTRATO PRODUCTO 1, 4 -alpha-Dglucooligosaccharide + H 2 O alpha-D-glucosa

SUBSTRATE PRODUCT 4 -methylumbelliferyl alpha 4 -methylumbelliferone + -D-glucopyranoside + H 2 O alpha-D-glucopyranose REACTION DIAGRAM

Sustrato/producto SUBSTRATE PRODUCT ORGANISM 1, 4 -alpha-D-glucooligosaccharide + H 2 O alpha-D-glucose Homo sapiens 4 -methylumbelliferyl alpha-D-glucopyranoside + H 2 O 4 -methylumbelliferone + alpha-D-glucopyranose Homo sapiens 4 -methylumbelliferyl-alpha-D-glucopyranoside + H 2 O 4 -methylumbelliferone + alpha-D-glucose Homo sapiens 4 -methylumbelliferyl-alpha-D-glucopyranoside + H 2 O 4 -methylumbelliferol + alpha-D-glucose Homo sapiens 4 -methylumbelliferyl-alpha-glucoside + H 2 O 4 -methylumbelliferone + alpha-D-glucose Homo sapiens 4 -nitrophenyl 2 -deoxy-alpha-D-glucopyranoside + H 2 O 4 -nitrophenol + 2 -deoxy-alpha-D-glucose Homo sapiens dextrin + H 2 O alpha-D-glucose + ? Homo sapiens glycogen + H 2 O alpha-D-glucose Homo sapiens maltopentaose + H 2 O alpha-D-glucose Homo sapiens maltose + H 2 O alpha-D-glucose Homo sapiens maltotetraose + H 2 O alpha-D-glucose Homo sapiens maltotriitol + H 2 O ? Homo sapiens p-nitrophenyl-alpha-D-glucopyranoside + H 2 O p-nitrophenol + alpha-D-glucose Homo sapiens p-nitrophenyl-alpha-D-glucopyranoside + H 2 O 4 -nitrophenol + D-glucose Homo sapiens palatinose + H 2 O alpha-D-glucose + D-fructose Homo sapiens resorufin alpha-D-glucopyranoside + H 2 O ? Homo sapiens starch + H 2 O alpha-D-glucose Homo sapiens maltotriose + H 2 O alpha-maltose + ? Homo sapiens http: //www. brenda-enzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword=&organism%5 B%5 D=Homo+sapiens&show_tm=0

Inhibidores INHIBITORS ORGANISM (2 R, 3 S, 4 S)-1 -[(2 S, 3 S)-2, 4 -dihydroxy-Homo sapiens 3 -(tridecyloxy)butyl]-3, 4 -dihydroxy 2(hydroxymethyl)tetrahydrothiophen ium http: //www. brenda-enzymes. org/Mol. php 4? n=318187

Inhibidores INHIBITORS (2 R, 3 S, 4 S)-1 -[(2 S, 3 S)-2, 4 -dihydroxy-3(tridecyloxy)butyl]-3, 4 -dihydroxy-2(hydroxymethyl)tetrahydrothiophenium (2 R, 3 S, 4 S)-1 -[(2 S, 3 S)-2, 4 -dihydroxy-3 methoxybutyl]-3, 4 -dihydroxy-2(hydroxymethyl)tetrahydrothiophenium (2 R, 3 S, 4 S)-1 -[(2 S, 3 S)-3 -(benzyloxy)-2, 4 dihydroxybutyl]-3, 4 -dihydroxy-2(hydroxymethyl)tetrahydrothiophenium (2 R, 3 S, 4 S)-1 -[(2 S, 3 S)-3 -ethoxy-2, 4 -dihydroxybutyl]3, 4 -dihydroxy-2(hydroxymethyl)tetrahydrothiophenium 1 -deoxynojirimycin 3'-(3 -methylbut-2 -enyl)-3', 4', 7 -trihydroxyflavane 3'-O-methylponkoranol ORGANISM Homo sapiens - Homo sapiens 3, 4 -dihydroxyisolonchocarpin Homo sapiens 4 -hydroxyisolonchocarpin Homo sapiens 8 -(1, 1 -dimethylallyl)-5'-(3 -methylbut-2 -enyl)-3', 4', 5, 7 - Homo sapiens tetrahydroxyflanvonol acarbose Homo sapiens acarbose blintol Brossoflurenone A Brossoflurenone B Broussochalcone A Broussochalcone B conduritol B epoxide D-glucono-delta-lactone COMMENTARY Homo sapiens Homo sapiens competitive inhibition, binds strongly to the enzyme inhibits the different subunits to different extents, with extraordinary selectivity for C-terminal subunit of the enzyme noncompetitive inhibition bound to the active site primarily through side-chain interactions with its acarvosine unit, almost no interactions with its glycone rings, binding structure, overview ; selenium analogue of salacinol noncompetitive inhibition active-site directed inhibitor - http: //www. brendaenzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword=&organism%5 B %5 D=Homo+sapiens&show_tm=0

de-O-sulfonated kotalanol de-O-sulfonated ponkoranol de-O-sulfonated salacinol glycogen Homo sapiens Homo sapiens - Hg 2+ Kazinol A Kazinol B Kazinol E kotalanol maltose maltotriose Homo sapiens Homo sapiens Homo sapiens - methyl-alpha-D-glucopyranoside Homo sapiens - miglitol N-butyl-deoxynojirimycin N-butyldeoxynojirimycin N-ethyl-deoxynojirimycin N-methyl-deoxynojirimycin NEM Nojirimycin Papyriflavonol A PCMB salacinol Sucrose Homo sapiens Homo sapiens Homo sapiens trehalose Homo sapiens - Tris turanose Zn 2+ Mn 2+ Homo sapiens - P 10253 - ; isolated from Salacia reticulata no inhbition of N-terminal subunit N 2 competitive inhibition of hydrolysis of 4 methylumbelliferyl-alpha-D-glucopyranoside, noncompetitive inhibition of hydrolysis of maltose Hg. Cl 2 ; isolated from Salacia reticulata hydrolysis of 4 -methylumbelliferyl-alpha-glucoside exhibits strong substrate inhibition; strong substrate inhibition no inhibition of maltose hydrolysis, competitive inhibition of glycogen hydrolysis competitive inhibition 2 m. M, 70% inhibition ; isolated from Salacia reticulata no inhibition of maltose hydrolysis, competitive inhibition of glycogen hydrolysis - http: //www. brenda-enzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword=&organism%5 B%5 D=Homo+sapiens&show_tm=0

Cofactor • No tiene http: //www. brendaenzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword=&organism%5 B%5 D =Homo+sapiens&show_tm=0

Usos de la maltasa • 1. Puede servir como un mecanismo de suplemento y apoyo para el malestar digestivo de los niños autistas • 2. Puede servir como un mecanismo de prevención y apoyo para la diarrea crónica • 3. Prevención del malestar digestivo asociado con trastornos digestivos congénitos

Referencias • BRENDA. (2014). BRENDA. Obtenido de The Comprehensive Enzyme Information System: http: //www. brendaenzymes. org/php/result_flat. php 4? ecno=3. 2. 1. 20&Suchword =&organism%5 B%5 D=Homo+sapiens&show_tm=0 • Group, E. (15 de Agosto de 2011). Global Healing Center. Obtenido de Global Healing Center: http: //www. globalhealingcenter. net/saludnatural/maltasa. html • KEGG. (2014). Kyoto Encyclopedia of Genes and Genomes. Obtenido de Kyoto Encyclopedia of Genes and Genomes: http: //www. genome. jp/dbget-bin/www_bget? ec: 3. 2. 1. 20