Proteasas de Helmintos Parsitos El caso de Fasciola
- Slides: 58
Proteasas de Helmintos Parásitos. El caso de Fasciola hepatica
Fasciola hepatica • Causa la Fasciolosis • Afecta rumiantes • Zoonosis emergente, varios millones infectados en Bolivia y Perú • Produce pérdidas multimillonarias a nivel global
Ciclo biológico de Fasciola hepatica
Problemas en el control de la Fasciolosis • Drogas efectivas pero costosas • Animales se reinfectan con facilidad • Tratamiento no evita el daño hepático • Focos de resistencia en Europa
Selección de los productos de excreción/ secreción (E/S) como objeto de estudio • Se pueden obtener en forma relativamente sencilla en cantidades aceptables a partir de gusanos adultos • La fasciola tiene intestino ciego por tanto regurgita el contenido. • Sus componentes entran en contacto con el medio interno del huésped. • Tienen composición menos compleja que el homogeneizado somático
ACTIVIDAD GELATINOLITICA DE LOS PRODUCTOS DE E/S DE FASCIOLA HEPATICA CL 1 gelatinolytic activity CL 1 27, 5 k. Da CL 2 29 k. Da CL 2 gelatinolytic activity
Catepsinas L de Fasciola • Son el 80% de los productos de E/S • Producidas y secretadas por células del tubo digestivo • CL 1 de 27, 5 k. Da es mayoritaria • CL 2 de 29 k. Da • Se diferencian por actividad sobre péptidos fluorogenicos sintéticos
Actividades de CL 1 y CL 2 de Fasciola hepatica sobre peptidos fluorogénicos acoplados a AMC Kcat/Km M-1. s-1
Actividades in vitro de los PES de Fasciola hepatica sobre Ig. G 1 humana Digestion of Ig. G 1 by Fasciola hepatica E/S products and immunological characterization of the main released products. Ig. G 1 l (100 mg) was incubated for 22 h with F. hepatica E/S products(10 mg) at p. H 7. 3 and 37 C. Proteins were run on 12. 5% SDS–PAGEunder nonreducing (left) and reducing conditions (right) and stained with CBB R-250 (lanes 1 through 4) or electrotransferred to nitrocelluelectrotransferred to identify the main digestion products by Western blotting using specific antisera (lanes a through h): Lanes 1 and 4, Ig. G 1 l undigested control; lanes 2 and 3, Ig. G 1 l 1 E/S products; lanes a and e, anti-L chain; lanes b and f, anti-Fd; lanes c and g, anti-Fcg, lanes d and h, anti-g 1 H chain.
Actividades in vitro de las Catepsinas L de Fasciola hepatica sobre Ig. Gs humanas Sitios de corte
Catepsinas L de Fasciola hepatica: Sitios de clivaje de Ig. Gs humanas
Actividades de PES y Catepsinas L de Fasciola hepatica sobre inmunoglobulinas humanas de clase Ig. G Conclusiones • CL 1 y CL 2 son las principales responsables de la degradación de las subclases de Ig. G con PES a p. H 7. 2 a manera de la papaína produciendo los fragmentos Fab y Fc • A p. H 5. 5 los PES producen la degradación adicional a fragmentos pequeños derivados de la porción Fc • Sólo Ig. G 3 es clivada en ausencia de DTT • Los sitios de corte determinados para CL 1 y CL 2 no se corresponden con los aa P 1 y P 2 de los sustratos sintéticos utilizados para determinar la actividad catepsina L (Phe-Arg )
Matriz extracelular y membranas basales
Actividad colagenolítica sobre colágeno fibrilar tipo I
Acividades sobre Fibronectina
Degradación de Laminina
Catepsinas L de Fasciola: Actividad proteolitica sobre componentes de la matriz extraceular y las membranas basales Conclusiones • Colágeno I: es degradado por los PES y en menor medida por CL 1 y CL 2 en presencia de Cys. • Colageno III: es clivado tanto por PES como por las CLs. • Colágeno IV: degradado completamente por los PES sin Cys, y por CL 1 y CL 2 en presencia de Cys. • Elastina: No se observa actividad proteolitica. • Laminina: Es cortada por PES, CL 1 y CL 2. • Fibronectina: Es atacada por PES, CL 1 y CL 2 produciendo patrones de corte diferentes.
Actividad fibrinogenolítica de CL 2: Formación del coágulo
Inhibición de las Catepsinas L de Fasciola hepatica por anticuerpos de conejos infectados • Conejos infectados con 30 MT c/u y sangrados hasta s 20 • Ig. Gs purificadas por afinidad • Incubación Ig. Gs con CLs, 20 min, relación 10: 1
Inhibición de las Catepsinas L de Fasciola hepatica por anticuerpos de conejos infectados y tratados • La actividad gelatinolítica de ambas catepsinas desaparece a las 4 -5 semanas postinfección y reaparece 2 -4 semanas después del tratamiento con triclabendazol
ENSAYO DE VACUNACION Groups: Wk 0 Inmumization (100 ug antígen in CFA) Cat. L 1 Cat. L 2 Control 4 Booster (100 ug antígeno in IFA) 6 Challenge (300 metacercariae) 20 Necropsy
ELISA ANALYSIS OF Ig. G RESPONSES AGAINST CL 1 AND CL 2 IN SHEEP FROM TRIAL 1 CL 2 CL 1 A. U. 300 600 250 500 200 400 150 300 100 200 50 100 0 2 4 6 8 10 12 14 Semanas 16 18 20 0 22 CONTROL CL 1 CL 2 2 4 6 8 10 12 14 16 Semanas 18 20 22
Worm burdens and FEC in sheep vaccinated against F. hepatica with CL 1 and CL 2 in Trial 1 Group Eggs/g Feces Egg output reducción (%) Flukes recovered % worm reduction CL 1 41, 8+/-41, 2 71 109, 1+/-24, 6 34 CL 2 28, 0+/-38 81 107+/-40, 1 33 Control 141, 8+/-75, 6 100 161, 4+/-21, 4 100
OTRAS PROTEASAS DE FASCIOLA HEPATICA • • DIPEPTIDIL PEPTIDASA (DPP) LEUCIN AMINOPEPTIDASA (LAP) CATEPSINA B LEGUMAINA
DIPEPTIDIL PEPTIDASA (DPP) • • Actividad presente en PES de adultos Clivaje preferncial de Gly-Pro y Lys-Ala Novel con relación a las DPPs de mamíferos Aún sin caracterización molecular
LAP de Fasciola hepatica • Metaloproteasa Zn++ dependiente purificada de extracto soluble en deoxicolato • Holoenzima hexamérica formada por subunidades de 67 k. Da • Asociada a tubo digestivo • Purificada por columna de afinidad con su inhibidor Bestatina • Trazas en los PES
TRIAL DESIGN Groups: Wk 0 Inmumization (100 ug antígen in CFA) CL 1+CL 2 LAP CL 1+CL 2+LAP Control 4 Booster (100 ug antígeno in IFA) 6 Challenge (300 metacercariae) 20 Necropsy
WESTERN BLOT ANALYSIS OF Ig. G RESPONSE AGAINST F. HEPATICA PROTEINASES IN SHEEP DURING THE COURSE OF VACCINATION TRIAL Groups: Control CL 1+CL 2 LAP CL 1+CL 2+LAP CL 2 CL 1 Weeks: P L 0 P L 12 P L 0 P L 6 P L 12 P =E/S products L =Leucine aminopeptidase P L 0 P L 6 P L 12
Ig. G ANTI-LAP RESPONSE IN GROUPS OF SHEEP VACCINATED AGAINST FASCIOLOSIS IN TRIAL 2 7000 A. U. 6000 5000 CONTROL 4000 LAP CL 1 -CL 2 3000 CL 1 -CL 2 -LAP 2000 1000 0 0 2 4 6 8 10 12 Weeks 14 16 18 20 22
Ig. G ANTI-CL 2 RESPONSE IN GROUPS OF SHEEP VACCINATED AGAINST FASCIOLOSIS IN TRIAL 2 450 A. U. 400 CONTROL 350 LAP CL 1 -CL 2 300 CL 1 -CL 2 -LAP 250 200 150 100 50 0 0 2 4 6 8 10 12 Weeks 14 16 18 20 22
Ig. G ANTI-CL 2 RESPONSE IN GROUPS OF SHEEP VACCINATED AGAINST FASCIOLOSIS IN TRIAL 2 A. U. 800 CONTROL 700 LAP 600 CL 1 -CL 2 -LAP 500 400 300 200 100 0 0 2 4 6 8 10 12 Weeks 14 16 18 20 22
Worm burdens recovered in sheep vaccinated against F. hepatica with CL 1, CL 2 and LAP in Trial 2 GROUP: CL 1 -CL 2 Animal No. GROUP: CONTROL Flukes recovered Animal No. Flukes recovered 104 56 101 126 110 89 119 59 114 0 122 54 121 0 134 56 125 5 139 65 128 1 Mean 72 135 0 136 0 137 57 Mean 23, 1
Worm burdens recovered in sheep vaccinated against F. hepatica with CL 1, CL 2 and LAP in Trial 2 GROUP: LAP Animal No GROUP: CL 1 -CL 2 -LAP Flukes recovered Animal No Flukes recovered 106 0 102 43 107 1 116 0 113 38 120 0 123 0 124 0 130 0 127 30 132 0 138 0 Mean 6, 5 Mean 12, 1
Reduction in F. hepatica worm burdens obtained in Trial 2 with CL 1, CL 2 and LAP Group Reduction (%) LAP 89, 6 CL 1 -CL 2 60, 1 CL 1 -CL 2 -LAP 79, 3
OVERVIEW OF VACCINATION TRIALS CONDUCTED IN SHEEP Antigen Protection Egg Output Reduction Pro. CL 1 r Not Significant ND CL 1 32% 71% CL 2 34% 81% Paramyosin 57% 85% CL 1 -CL 2 60% 82% CL 1 -CL 2 -LAP 79% 82% LAP 90% 91%
Ensayos in vitro muestran una correlación positiva entre la capacidad de inhibición de la actividad enzimática por parte de los anticuerpos LAP específicos y los niveles de protección alcanzados
Construcción del producto LAP completo M 3´ 5´ 5´RACE 3´RACE 5 Ciclos Generación de FL 2 Kb 1, 3 kb PCR 20 Ciclos Amplificación de FL
Fh. LAP is a member of the M 17 family of metalloproteases (MEROPS) Neighbor joining unrooted tree of the conserved C-terminal domain of LAPs Acosta et al, 2008
Purificación M 1 2 3 4 5 6 7 8 500 ml de cultivo Columna quelante Hi Trap (Ni) Binding: 50 m. M Tris 01 M Na. Cl p. H 8. 3 Elución: Imidazol 50 m. M 1 Muestra 4, 5, 6 Eluidos 2 No retenido 7 s/ inducir 3 Control 8 inducido
Purification of Fh. LAPr using Pro. Bond™ resin Acosta et al, 2008
MODELADO MOLECULAR DE Fh. LAP
Catabolismo de la hemoglobina GLOBULOS ROJOS HEMOLISIS saposina Hb esófago ENDOPEPTIDASAS ej: catepsina L 1 -2 catepsina B catepsina D POLIPEPTIDOS LEGUMAINA gastrodermis lúmen del ciego EXOPROTEASAS ej: catepsina C, DPP Aminopeptidasa? DIPÉPTIDOS AA? gastrodermis lúmen del ciego
Reactividad cruzada entre Fh. LAPn y Fh. LAPr Inmunoblot Suero de oveja inmunizada con Fh. LAPn Suero de conejo inmunizado con Fh. LAPr SDS PAGE 12, 5% condiciones reducidas
Fh. LAP is localized in gastrodermal cells by IEM Negative Control
Maldi-Tof de Fh. LAPn 14 péptidos 192 residuos reconocidos en 523 36, 7% de cobertura >Fhe. LAPr MAALAVGVSDLSDKRFDVVIFINDDADEGCAKDAAVYEALKSFSKINPNLGSELSIVPFPAHPSGRLIYSPTGALNTDTADIR NVYDAACAGVKRALSMGCHAPLLYLGSLRSASFGFEWMQRKHLLLNALLGAYHALYLPLEVREMRPTTGLKAQHLGVKEDTKG SDELVLRLAMALEEGRWLARDIGGSDPERMAAPRIVDYLKTSLGGMKGITMSVEKVDIQKYPLMAAVNRAASVVARHDGRVVH LKYEPPNPTEVDTTLYLIGKGITYDTGGADIKANGVMAGMHRDKCGAAAIAGLFKTLGELQPPGLSVSAALAFVRNSVGADSY VADEILVARSGQRIRVGNTDAEGRMVMTDLLCEAKEKAINATNPFLFTIATLTGHVVRAYKHYTAVMDNGPPRIHRVSQSLQE AGDRISDMAEISTVRKEDYEFNRGKTEYEDTLQCNNLPSSATPRGHQIPAAFMALASGLDKHGLGSAKPIPYTHVDVAGSATE IHVLPTAAPLLMFASRYVLPRLGFK
Actividad frente a distintos aminoácidos nmol/min. mg Sustrato Fh. LAPr Fh. LAPn Leu-AMC 214. 5 ± 5. 5 134. 4± 0. 5 Arg-AMC 29. 1 ± 0. 8 75. 2 ± 0. 0 Ala-AMC 7. 5 ± 0. 1 8. 32 ± 0. 0 Phe-AMC 6. 8 ± 0. 2 14. 08 ± 0. 0 Tyr-AMC 6. 4 ± 0. 5 5. 44 ± 0. 0 Pro-AMC 5. 6 ± 0. 1 3. 2 ± 0. 2 Ser-AMC 2. 1 ± 0. 1 1. 92 ± 0. 0 Gly-AMC 1. 9 ± 0. 1 0. 544 ± 0. 0 Glu-AMC 0. 12 ± 0. 1 0. 224 ± 0. 0
Respuesta humoral de ovinos (ELISA) 0 44 6 Priming Recuerdo Desafio 10 15 20 25
Recuperación de parásitos en ensayo de inmunización en conejos Grupo N° de parásitos recuperados Promedio ± DS Parásitos/animal Grupo Fh. LAPr (n=6) 2 ± 1. 67 4; 0; 3; 3; 2; 0 Control (n=6) 9 ± 1. 78 Recuperación Grupo Control = 18% Grupo Inmunizado = 4% 10; 12; 8; 8; 7; 9 Porcentaje de Protección (Control – Inmunizado) x 100 Control 78%
Vaccine trial using Fh. LAPr mixed with different adjuvants GROUPS FCA + FIA Adyuvac 50 Alum Ribi DEAE-Dextran Control (FCA + FIA) n = 10 Wk 0 Inmumization 100 ug Ag 4 Booster 100 ug Ag 6 Challenge n = 10 n = 10 18 Necropsy 200 metacercariae Maggioli et al, 2011
Parasitological findings in adjuvant trial Groups Recovered worms Mean ± SD recovered worms Recovery % Protection % Egg viability % Size of recovered worms (mm) Lenght Width Control 94, 30, 46, 73, 76, 114, 34, 93, 85, 31 67. 6 ± 30. 3 33. 8 ______ 36. 1 19. 4 ± 2. 5 8. 9 ± 1. 3 FCA + FIA 5, 3, 11, 4, 16, 10, 21, 24, 3 11. 0 ± 7. 5 5. 5 83. 8* 27. 5 19. 5 ± 3. 5 8. 0 ± 1. 6 Adyuvac 50 20, 19, 16, 49, 17, 24, 9, 3, 13, 3 17. 3 ± 13. 1 8. 5 74. 4* 20. 3* 18. 2 ± 2. 6 8. 7 ± 1. 4 Alum 14, 4, 2, 1, 8, 1, 20, 0, 14, 25 8. 9± 8. 8 4. 4 86. 9* 9. 6* 19. 1 ± 3. 9 7. 9 ± 1. 6 DEAE-D 95, 34, 8, 18, 38, 42, 30, 26, 30, 21 34. 2 ± 24. 6 17. 1 49. 5* 18. 3* 18. 6 ± 2. 1 9. 0 ± 1. 2 Ribi 26, 23, 18, 44, 20, 56, 41, 10, 77, 25 34. 0 ± 20. 5 17. 0 49. 8* 54. 1* 19. 0 ± 2. 7 9. 3 ± 1. 3 Maggioli et al, 2011
Total Ig. G response against Fh. LAPr in vaccinated groups FCA/FIA Adyuvac 50 Alum DEAE-D RIBI Control Maggioli et al, 2011
A. U. Worm recovery Sample size 60 Correlation coefficient r -0, 2820 Significance level P=0, 0336 95% Confidence interval for r -0, 5054 to -0, 02309
Ig. G 1 response against Fh. LAPr in vaccinated groups at different time points 90000 80000 2 weeks post immunization 6 weeks post immunization 70000 8 weeks post immunization 16 weeks post immunization Arbitrary units 60000 50000 40000 30000 20000 10000 0 Freund+LAP Adyuvac 50+LAP Alum+LAP DEAE+LAP RIBI+LAP Freund+PBS
Ig. G 2 response against Fh. LAPr in vaccinated groups at different time points 60000 2 weeks post immunization 50000 6 weeks post immunization 8 weeks post immunization Arbitrary units 40000 16 weeks post immunization 30000 20000 10000 0 Freund+LAPAdyuvac 50+LAP Alum+LAP DEAE+LAP RIBI+LAP Freund+PBS
Anti Fh. LAPr Ig. G 1/Ig. G 2 ratio in vaccinated groups at different time points 6 5 2 weeks post immunization 6 weeks post immunization 8 weeks post immunization 16 weeks post immunization 4 3 2 1 PB S P Fr eu nd + A +L A E+ L EA D RI BI P P A m +L lu A 50 +L A dy uv ac A un d+ L A P P 0 Fr e Ig. G 1/Ig. G 2 7
Vaccine trial using Fh. LAPr mixed with Adyuvac 50 1 vs 2 boosters GROUPS Adyuvac 50 control 1 x LAP 1 x Adyuvac 50 control 2 x LAP 2 x Wk Wk 0 4 Priming 100 ug Booster 100 ug 0 Priming 100 ug 4 Booster 100 ug n=6 n=6 6 18 Infection 200 mets Necropsy 8 Booster 100 ug 10 Infection 200 mets 20 Necropsy
Parasitological findings in Adyuvac 50 trial Groups Recovered worms Mean recovered worms Recovery % Protection % Size of recovered worms (mm) Lenght Width Control x 1 36, 105, 53, 11, 55, 38 49. 5 24. 7 ______ 20. 2 ± 3. 7 9. 4 ± 1. 9 r. Fh. LAP x 1 6, 10, 11, 36, 7, 3 12. 3 6, 1 75. 2* 18. 7 ± 2. 9 8. 4 ± 1. 1 Control x 2 54, 35, 61, 56, 59, 54 53. 1 26. 5 19. 3 ± 3. 2 8. 0 ± 1. 0 r. Fh. LAP x 2 28, 13, 42, 44, 90, 27 40. 8 20. 4 18. 6 ± 2. 5 8. 7 ± 1. 2 ______ 26. 2
- Parsitos
- Helmintos taxonomia
- Subreino metazoa
- Ramas de la parasitologia
- Ch3ch2h2o
- Proteasas
- Alfa-cetoácidos
- Tipos de contenido gástrico
- Emulsificación de grasas
- Eurytrema pancreaticum life cycle
- Struktur platyhelmintes
- Fasciola hepatica class
- Dorsoventrally flattened phylum
- Fasciola hepatica
- Porto-systemic anastomosis
- Siklus hidup taenia saginata
- Chephalopoda
- Fasciola hepatica ppt
- Fasciola hepatica
- Termasuk ke dalam filum
- Esquistossomulo
- Opistorchiformes
- Fasciola
- Parasitology
- Siklus hidup fasciola hepatica
- Ciri insecta
- Caso enro
- Caso iridium
- Estadiamento de tanner
- Foda de motorola
- Diagrama de caso de uso ejemplos
- Caso degollado power point
- Estudio de caso
- Ejemplo de una teoría del caso
- Estudo de caso taylor resolve um problema
- Producto y cociente notable
- Preciso chamar os adultos
- Tercer caso de racionalización
- Caso clinico
- Caso ford
- Caso clinico de neumonia
- Caso chispas
- Tatiana tarasoff
- Caso fortuito
- Caso ford pinto
- Caso livia
- Coesão referencial
- Diagrama de flujo en caso de accidente laboral
- Champinha caso
- Caso clinico veterinario
- Caso 1
- Prolactina valores normales
- Diagrama caso de uso
- Ejemplo de examen fisico segmentario
- Diagrama caso de uso
- Caso clinico pancreatite aguda
- Erika gallardo
- Luis gabriel gonzalez higuera
- Casos notaveis da multiplicaçao