Omalizumab Drugbank ID DB 00043 Protein chemical formula

Omalizumab Drugbank ID : DB 00043 Protein chemical formula : C 6450 H 9916 N 1714 O 2023 S 38 Protein average weight : 145058. 2000 Half-life : 26 days

Description A recombinant DNA-derived humanized Ig. G 1 k monoclonal antibody that selectively binds to human immunoglobulin E (Ig. E). Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. Indication For treatment of asthma caused by allergies Pharmacodynamics Xolair inhibits the binding of Ig. E to the high-affinity Ig. E receptor (Fce. RI) on the surface of mast cells and basophils. Reduction in surface-bound Ig. E on Fce. RI-bearing cells limits the degree of release of mediators of the allergic response. Xolair is used to treat severe, persisten asthma. Mechanism Of Action Xolair binds to Ig. E (a class of antibodies normally secreted in allergic responses), which prevents their binding to mast cells and basophils.

Metabolism Most likely removed by opsonization via the reticuloendothelial system. Route of elimation Liver elimination of Ig. G includes degradation in the liver reticuloendothelial system (RES) and endothelial cells. Intact Ig. G is also excreted in bile. Volume of Distribution • 78 ± 32 m. L/kg Categories Anti-Allergic Agents and Anti-Asthmatic Agents and Immunosuppressive Affected Organism Humans and other mammals Patents Country Canada Patent Number 2113813 1340233 Approved 2005 -04 -12 1998 -12 -15 Expires (estimated) 2012 -08 -14 2015 -12 -15

Sequence Omalizumab heavy chain VQLVESGGGLVQPGGSLRLSCAVSGYSITSGYSWNWIRQAPGKGLEWVASITYDGSTNYA DSVKGRFTISRDDSKNTFYLQMNSLRAEDTAVYYCARGSHYFGHWHFAVWGQGTLVTVS SGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK Omalizumab light chain DIQLTQSPSSLSASVGDRVTITCRASQSVDYDGDSYMNWYQQKPGKAPKLLIYAASYLESGV PSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSHEDPYTFGQGTKVEIKRTVAAPSVFIFPPSD EQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNR Targets High affinity immunoglobulin epsilon receptor subunit alpha, High affinity immunoglobulin epsilon receptor subunit beta

Brands : Xolair Company : Genentech Inc Description : Xolair is a recombinant DNA-derived humanized Ig. G 1τ monoclonal antibody that selectively binds to human immunoglobulin E (Ig. E). The antibody has a molecular weight of approximately 149 kilo. Daltons. Xolair is produced by a Chinese hamster ovary cell suspension culture in a nutrient medium containing the antibiotic gentamicin. Gentamicin is not detectable in the final product Used For/Prescribed for : Xolair is used to treat moderate to severe asthma that is caused by allergies, and chronic idiopathic urticaria (a form of chronic hives) in adults and children who are at least 12 years old. Xolair is usually given after other asthma medications have been tried without successful treatment of symptoms. Formulation : It is formulated in a single use vial that is reconstituted with Sterile Water for Injection (SWFI), USP, and administered as a subcutaneous (SC) injection. Each 202. 5 mg vial of omalizumab also contains L-histidine (1. 8 mg), Lhistidine hydrochloride monohydrate (2. 8 mg), polysorbate 20 (0. 5 mg) and sucrose (145. 5 mg) and is designed to deliver 150 mg of omalizumab in 1. 2 m. L after reconstitution with 1. 4 m. L SWFI, USP.

Form : sterile, white, preservative free, lyophilized powder Route of administration : subcutaneous injection Dosage : Administer Xolair 150 to 375 mg by subcutaneous injection every 2 or 4 weeks. Determine doses (mg) and dosing frequency by serum total Ig. E level (IU/m. L), measured before the start of treatment, and body weight (kg) as if serum Ig. E is less than 30 -100 IU/ml, then !50 mg of drug is for people having 3060 Kg of body weight and similarl amount for 60 -90 kg of weight but for people having weight between 90 -150 Kg, dose is recommended as 300 mg. Contraindication : Severe hypersensitivity Side effects : wheezing, tightness in your chest, trouble breathing; hives or skin rash; feeling anxious or light-headed, fainting; warmth or tingling under your skin; or swelling of your face, lips, tongue, or throat. pain; headache, tired feeling; joint or muscle pain; dizziness; ear pain; hair loss; mild itching or skin rash; sore throat or cold symptoms; or redness, bruising, warmth, burning, stinging, itching, pain, or swelling of your skin where the injection was given.

General References # Karagiannis SN, Wang Q, East N, Burke F, Riffard S, Bracher MG, Thompson RG, Durham SR, Schwartz LB, Balkwill FR, Gould HJ: Activity of human monocytes in Ig. E antibody-dependent surveillance and killing of ovarian tumor cells. Eur J Immunol. 2003 Apr; 33(4): 1030 -40. "Pubmed": http: //www. ncbi. nlm. nih. gov/pubmed/12672069

Refrence http: //www. xolair. com/ http: //www. drugs. com/xolair. html http: //www. drugs. com/druginteractions/omalizumab, xolair-index. html? filter=1 http: //www. rxlist. com/xolair-drug. htm