MODELLER handson http salilab orgmodeller Ben Webb Sali
MODELLER hands-on http: //salilab. org/modeller/ Ben Webb, Sali Lab, UC San Francisco Maya Topf, Birkbeck College, London
Obtaining the Modeller software Download the latest version (9 v 1) from our website: http: //salilab. org/modeller/ For Mac, this will be the modeller-9 v 1. dmg file But also available for Linux, Windows and some ancient Unix systems (Alpha, Solaris, AIX, IRIX) To activate for academic use, fill out the license agreement; a license key will be emailed to you The website also links to more detailed tutorials, the online manual, users’ mailing list, publications, etc.
Running Modeller is actually a powerful library of functions and Python classes for handling protein structures and alignments Pro: not just limited to comparative modeling; you can add your own functionality (e. g. custom energy terms) in C or Python, or use the Python module from other programs Pro: can also superpose structures, search sequence databases, fit against EM data, etc. Con: there is no point and click interface; to build a model, you must write a short Python script… but for most applications, these scripts are very simple, and you can use the examples as your templates
Running Modeller Required inputs: Target sequence (PIR format) Template structure(s) (PDB format) Python script file Outputs: Target-template alignment PDB model file(s) Log and data files (objective function and restraint violations) (Optionally, you can find templates and/or build the alignment with another program and so skip the alignment step)
Installation (1)
Installation (2)
Installation (3)
Installation (4)
Installation (5)
Modeller example, step 1 Example: build a model of one chain of the Gro. EL Step 1: put the sequence in PIR format: >P 1; 1 oel sequence: 1 oel: 1 : : 522 ‘align code’: an identifier used to identify the type of sequence; often ‘structure. X’ for X-ray sequence. Oftento. PDB + chain ID (e. g. 1 xyz. A) atom file name readcode structural information from structures, or ‘sequence’ for sequence only : : undefined: -1. 00 (usually the PDB code); unused in this case AKDVKFGNDAGVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEV ASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTVAVEELKALSVPCSDSKAIAQVGTISA NSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKI the amino acid sequence, terminated by a ‘*’ character EEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVA SNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATAVVNTIRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVIS VIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLR QIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDL* Look up ‘alignment file format’ in the Modeller manual index for more information
Modeller example, step 1 All Modeller input files are ‘plain text’ I always work from a terminal window and use ‘vi’ to edit my text files, but… emacs works too If you want to use a graphical text editor, make sure you save the file in plain text (not Unicode) For Mac’s Text. Edit application, use ‘Make Plain Text’ from the Format menu For Windows, use Notepad or be very careful to save in plain text otherwise (and watch out for Windows “helpfully” adding or hiding file extensions)
Step 2: create Python script for targettemplate alignment from modeller import * env = environ() aln = alignment(env) mdl = model(env, file='1 we 3', model_segment=('FIRST: B', 'LAST: B')) aln. append_model(mdl, align_codes='1 we 3 B', atom_files='1 we 3') aln. append(file='1 oel. seq', align_codes='1 oel') aln. align 2 d(max_gap_length=80) aln. write(file='1 oel-1 we 3. ali', alignment_format='PIR')
Step 3: run the script Save the sequence as 1 oel. seq, and the Python script as align 2 d. py Also download the 1 we 3 structure from PDB, and put it in the same directory as the other two files Both Modeller and Python are very strict about syntax – check that you have commas, brackets etc. in the right places Open a terminal window (Linux) (on Mac/Windows, run the Modeller application which gives you a terminal window), then run with mod 9 v 1 align 2 d. py Any errors (Python exceptions) come out on standard error
Step 4: build comparative models from modeller import * from modeller. automodel import * env = environ() a = automodel(env, alnfile='1 oel-1 we 3. ali', knowns='1 we 3 B', sequence='1 oel', assess_methods=assess. DOPE) a. starting_model = 1 a. ending_model = 3 a. make() Run in the same way as the alignment Python script earlier
Step 5: view final models On successful completion, the Modeller log file will contain details on the models, and 3 model files will be produced (1 oel. B 9999*. pdb) Can be viewed in any PDB viewer, e. g. Chimera Next steps to work on: Fit a model into the EM density map to assess quality Build models with a different template, with loop refinement Fit new models and compare See the README file in your input files directory results directory contains the results (if you get stuck!)
- Slides: 15