Insulin porcine DB 00071 Approved Drug Chemical Formula
Insulin, porcine (DB 00071) Approved Drug Chemical Formula: C 257 H 387 N 65 O 76 S 6 Molecular Weight: 5795. 6 Insulin isolated from pig pancreas. Composed of alpha and beta chains, processed from pro-insulin. Forms a hexameric structure. Indication/Usage For the treatment of type I and II diabetes mellitus. . Pharmacodynamics Insulin is used in the treatment of type I and type II diabetes. The primary activity of insulin is the regulation of glucose metabolism. In muscle and other tissues (except the brain), insulin causes rapid transport of glucose and amino acids intracellularly. It also promotes anabolism, and inhibits protein catabolism. In the liver, insulin promotes the uptake and storage of glucose in the form of glycogen, inhibits gluconeogenesis, and promotes the conversion of excess glucose into fat. Mechanism Of Action Insulin is used in the treatment of type I and type II diabetes. The primary activity of insulin is the regulation of glucose metabolism. In muscle and other tissues (except the brain), insulin causes rapid transport of glucose and amino acids intracellularly.
It also promotes anabolism, and inhibits protein catabolism. In the liver, insulin promotes the uptake and storage of glucose in the form of glycogen, inhibits gluconeogenesis, and promotes the conversion of excess glucose into fat. Metabolism Insulin is predominantly cleared by metabolic degradation via a receptor-mediated process. Category Hypoglycemic Agents Affected Organisms Human and other Mammals Sequence A Chain: GIVEQCCTSICSLYQLENYCN B Chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT Experimental Properties Solubilty in water: Slightly soluble Hydrophobiity: 0. 218 Isoelectric Point: 5. 39 Targets Insulin receptor, Insulin-like growth factor 1 receptor, Insulin-degrading enzyme, HLA class II histocompatibility antigen, DQ alpha 2 chain, HLA class II histocompatibility antigen, DQ beta 1 chain, Retinoblastoma-associated protein, Cathepsin D, Carboxypeptidase E, Neuroendocrine convertase 2, Neuroendocrine convertase 1, Protein NOV homolog, Low-density lipoprotein receptor-related protein 2, Insulin-like growth factor-binding protein 7, Synaptotagmin-like protein 4
Brands Vetsulin – Intervet Inc (Merck Animal Health) Vetsulin is a sterile aqueous zinc suspension of purified porcine insulin. Vetsulin is supplied as a sterile injectable suspension in multidose vials containing 10 m. L of 40 IU/m. L porcine insulin zinc suspension. Vials are supplied in cartons of one, 10 m. L vial. These vials are recommended to be administered as subcutaneous injection. Formulation purified porcine insulin 40 IU (35% amorphous and 65% crystalline), Zinc (as chloride) 0. 08 mg, Sodium acetate trihydrate 1. 36 mg, Sodium chloride 7. 0 mg, Methylparaben (preservative) 1. 0 mg, p. H is adjusted with hydrochloric acid and/or sodium hydroxide. Used/Prescribed for vetsulin® (porcine insulin zinc suspension) is indicated for the reduction of hyperglycemia and hyperglycemia-associated clinical signs in dogs and cats with diabetes mellitus. Dosage In dogs: The initial recommended vetsulin® dose is 0. 5 IU insulin/kg body weight. Initially, this dose should be given once daily concurrently with, or right after a meal; In Cats: The initial recommended dose in cats is 1 to 2 IU per injection. The injections should be given twice daily at approximately 12 hour intervals. Contraindications Dogs and cats known to have a systemic allergy to pork or pork products should not be treated with vetsulin® is contraindicated during periods of hypoglycemia.
Side-effects In dogs: Clinical signs of hypoglycemia were generally mild in nature (described as weakness, lethargy, stumbling, falling down, and/or depression, hematuria, vomiting, diarrhea, pancreatitis, non-specific hepatopathy/pancreatitis, development of cataracts, and urinary tract infections. In Cats: omiting, lethargy, diarrhea, decreased appetite/anorexia, pancreatitis, dermal events, respiratory disease, urinary tract disorder, renal disease, dehydration, weight loss, polydipsia, polyuria, behavioral change, and ocular discharge/conjunctivitis. Drug Interactions In the US clinical effectiveness studies, dogs and cats received various medications while being treated with vetsulin® including antimicrobials, antivirals, antifungals, antihistamines, analgesics, anesthetics/tranquilizers, diuretics, bronchodilators, corticosteroids (cats), NSAIDs, thyroid hormone supplementation, hyperthyroid medication (methimazole), internal and external parasiticides, antiemetics, dermatological topical treatments and oral supplements, ophthalmic preparations containing antimicrobials and antiinflammatories, and various vaccines. No medication interactions were reported. References 1. http: //dailymed. nlm. nih. gov/dailymed/archives/fda. Drug. Info. cfm? archiveid=101642
- Slides: 4