Color Blindness By Jessie Wright The normal human

Color Blindness By Jessie Wright

The normal human retina contains two kinds of light sensitive cells: the rod cells (active only in low light) and the cone cells (active in normal daylight and responsible for color perception). Normally, there are three kinds of cones (each one sensitive to a specific range of wavelengths): "red" cones (64%) "green" cones (32%) "blue" cones (2%) The different kinds of inherited color blindness result from partial or complete loss of function of one or more of the different cone systems.

Different Types of Color Blindness • Monochromacy: occurs when two or all three of the cone pigments are missing and color and lightness vision is reduced to one dimension. – Total color blindness • Dichromacy: occurs when only one of the cone pigments is missing and color is reduced to two dimensions. – Partial color blindness red-green blue-yellow

Total Color Blindness Also known as rod monochromacy, complete achromatopsia, and typical monochromacy. A rare, non-progressive inability to distinguish any colors as a result of absent or nonfunctioning retinal cones. See everything as white, black, or some shade of gray Typically caused by a missense mutation (a switched amino acid) in the CNGB 3 gene.

CYCLIC NUCLEOTIDE-GATED CHANNEL, BETA-3 (CNGB 3) Classic achromatopsia results from a complete loss of CNGB 3 function. CNGB 3 encodes for the beta subunit of the cone cyclic nucleotide-gated cation channel, found photoreceptor plasma membranes. Upon activation by c. GMP, it leads to an opening of cation channels which thereby cause a depolarization of rod photoreceptors. This gene is essential for the generation of light -evoked electrical responses in cones. CNGB 3 is not required for vital processes outside the visual system.

CNGB 3 Cont. The human CNGB 3 gene consists of 18 exons distributed over 200 kb of genomic sequence. Gene type: protein coding Domain: similar to ion transport protein Cytogenetic locus: chromosome: 8; Location: 8 q 21 -q 22

Amino acid sequence • Length: 809 aa "MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQE ENKGEEKSLKTKSTPVTSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQK EMDPGKEGPNSPQNKPPAAPVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEA SPQTAKPTAVPPVKESDDKPTEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDRLY LLWLLLVTLAYNWNCWFIPLRLVFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQ FVRGGDIIVDSNELRKHYRTSTKFQLDVASIIPFDICYLFFGFNPMFRANRMLKYTSF FEFNHHLESIMDKAYIYRVIRTTGYLLFILHINACVYYWASNYEGIGTTRWVYDGEGN EYLRCYYWAVRTLITIGGLPEPQTLFEIVFQLLNFFSGVFVFSSLIGQMRDVIGAATA NQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQRMLDESDLLKTLPTTVQL ALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSVLYLPGDFVCKKGEIGKEMYIIKH GEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVAHGFANLLTLDKKTL QEILVHYPDSERILMKKARVLLKQKAKTAEATPPRKDLALLFPPKEETPKLFKTLLGG TGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDKQKENEDKGKENEDK DKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTSRQSLIISMAPSAEGGEEV LTIEVKEKAKQ"

Mutation… • The genetic basis for achromatopsia is found on chromosome 8 (location 8 q 21 -q 22) where there is a recessive point mutation in CNGB 3 that changes serine at residue 435 to phenylalanine in a highly conserved site in the S 6 membranespanning domain.

Bibliography • • • Bookshelf: Samir S Deeb, Ph. D, Arno G Motulsky, MD, “Red-Green Color Vision Defects, ” Gene. Reviews, September 19, 2005. Berg, Jeremy M. “ 32. 3. 5. Rearrangements in the Genes for the Green and Red Pigments Lead to ‘Color Blindness, ’” Biochemistry 5 th edition, W. H. Freeman and Company, 2002. • • • OMIM: • • Pub. Med: • • “COLORBLINDNESS, PARTIAL, DEUTAN SERIES; CBD” OMIM ID: 303800 Harrison, R. ; Hoefnagel, D. ; Hayward, J. N. “Congenital total color blindness. ” Arch. Ophthal. 64: 685 -692, 1960. Pub. Med ID: 13711836 Botstein, D. “The molecular biology of color vision. ” (Editorial) Science 232: 142 -143, 1986. Pub. Med ID: 2937146 Reyniers, E. ; Van Thienen, M. -N. ; Meire, F. ; De Boulle, K. ; Devries, K. ; Kestelijn, P. ; Willems, P. J. “Gene conversion between red and defective green opsin gene in blue cone monochromacy. ” Genomics 29: 323 -328, 1995. Pub. Med ID: 8666378 Winderickx, J. ; Sanocki, E. ; Lindsey, D. T. ; Teller, D. Y. ; Motulsky, A. G. ; Deeb, S. S. : “Defective colour vision associated with a missense mutation in the human green visual pigment gene. ” Nature Genet. 1: 251 -256, 1992. Pub. Med ID: 1302020