Collagenase Drugbank ID DB 00048 Protein chemical formula
Collagenase Drugbank ID : DB 00048 Protein chemical formula : C 5028 H 7666 N 1300 O 1564 S 21 Protein average weight : 112023. 2000
Description The enzyme collagenase is derived from fermentation of Clostridium histolyticum Indication Used to promote debridement of necrotic tissue in the treatment of severe burns and dermal ulcers including decubitus ulcers. Pharmacodynamics Used in the treatment of skin ulcers and sever burns, collagenase is able to digest collagen in necrotic tissue at physiological p. H by hydrolyzing the peptide bonds of undenatured and denatured collagen. Collagenase thus contributes towards the formation of granulation tissue and subsequent epithelization of dermal ulcers and severely burned areas. The action of collagenase may remove substrates necessary for bacterial proliferation or may permit antibodies, leukocytes, and antibiotics better access to the infected area.
Mechanism Of Action Collagenase is a protease that is specific to collagen. The triple helical region of interstitial collagens is highly resistant to most cell proteinases. However, during remodeling of the connective tissue in such processes as wound healing and metastasis, collagen becomes susceptible to cleavage by collagenases. Collagenase cleaves all 3 alpha helical chains of native Types I, II and III collagens at a single locus by hydrolyzing the peptide bond following the Gly residue of the sequence: Gly 775 -(Ile or Leu) 776 -(Ala or Leu) 777 located approximately threefourths of the chain length from each N-terminus Affected Organism Humans and other mammals
Sequence MKRKCLSKRLMLAITMATIFTVNSTLPIYAAVDKNNATAAVQNESKRYTVSYLKTLNYY DLVDLLVKTEIENLPDLFQYSSDAKEFYGNKTRMSFIMDEIGRRAPQYTEIDHKGIPTLV EVVRAGFYLGFHNKELNEINKRSFKERVIPSILAIQKNPNFKLGTEVQDKIVSATGLLAGN ETAPPEVVNNFTPILQDCIKNIDRYALDDLKSKALFNVLAAPTYDITEYLRATKEKPENTP WYGKIDGFINELKKLALYGKINDNNSWIIDNGIYHIAPLGKLHSNNKIGIETLTEVMKVY PYLSMQHLQSADQIKRHYDSKDAEGNKIPLDKFKKEGKEKYCPKTYTFDDGKVIIKAGA RVEEEKVKRLYWASKEVNSQFFRVYGIDKPLEEGNPDDILTMVIYNSPEEYKLNSVLYGY DTNNGGMYIEPEGTFFTYEREAQESTYTLEELFRHEYTHYLQGRYAVPGQWGRTKLYD NDRLTWYEEGGAELFAGSTRTSGILPRKSIVSNIHNTTRNNRYKLSDTVHSKYGASFEFY NYACMFMDYMYNKDMGILNKLNDLAKNNDVDGYDNYIRDLSSNYALNDKYQDHM QERIDNYENLTVPFVADDYLVRHAYKNPNEIYSEISEVAKLKDAKSEVKKSQYFSTFTLRG SYTGGASKGKLEDQKAMNKFIDDSLKKLDTYSWSGYKTLTAYFTNYKVDSSNRVTYDV VFHGYLPNEGDSKNSLPYGKINGTYKGTEKEKIKFSSEGSFDPDGKIVSYEWDFGDGNK SNEENPEHSYDKVGTYTVKLKVTDDKGESSVSTTTAEIKDLSENKLPVIYMHVPKSGALN QKVVFYGKGTYDPDGSIAGYQWDFGDGSDFSSEQNPSHVYTKKGEYTVTLRVMDSSG QMSEKTMKIKITDPVYPIGTEKEPNNSKETASGPIVPGIPVSGTIENTSDQDYFYFDVITP GEVKIDINKLGYGGATWVVYDENNNAVSYATDDGQNLSGKFKADKPGRYYIHLYMFN GSYMPYRINIEGSVGR
Targets Collagen alpha-1(I) chain, Collagen alpha-1(III) chain, Collagen alpha-2(I) chain
Brands : Santyl Company : Advance Biofactures Corp Description : Collagenase Santyl® (collagenase) Ointment is a sterile enzymatic debriding ointment which contains 250 collagenase units per gram of white petrolatum USP. The enzyme collagenase is derived from the fermentation by Clostridium histolyticum. It possesses the unique ability to digest collagen in necrotic tissue. Used For/Prescribed for : It is used for removing dead skin from wounds and burned areas. Santyl ointment is an enzymatic debriding ointment. It works by breaking down dead skin. Formulation : Collagenase Santyl® Ointment contains 250 units of collagenase enzyme per gram of white petrolatum USP. The potency assay of collagenase is based on the digestion of undenatured collagen (from bovine Achilles tendon) at p. H 7. 2 and 37°C for 24 hours. The number of peptide bonds cleaved are measured by reaction with ninhydrin. Amino groups released by a trypsin digestion control are subtracted. One net collagenase unit will solubilize ninhydrin reactive material equivalent to 4 micromoles of leucine. Collagenase Santyl (collagenase) ® Ointment is available in 15 gram and 30 gram tubes.
Form: sterile enzymatic debriding ointment Route of administration : Apply on the affected area. Dosage : Collagenase Santyl (collagenase) ® Ointment should be applied once daily (or more frequently if the dressing becomes soiled as from incontinence). Contraindication : hypersensitivity Side effects : SEVERE side effects may be: Severe allergic reactions (rash; hives; itching; difficulty breathing; tightness in the chest; swelling of the mouth, face, lips, or tongue); signs of infection (eg, fever, chills, or persistent sore throat). Drug Interaction : A total of 5 drugs (14 brand generic names) are known to interact moderately with Santyl (collagenase topical). Grafco Silver Nitrate (silver nitrate topical) Mersol (thimerosal topical) Silvadene (silver sulfadiazine topical) Silvadene Cream 1% (silver sulfadiazine topical) Silva. Sorb (silver topical) silver nitrate topical silver sulfadiazine topical silver / zinc oxide topical Silvr. STAT (silver topical) SSD (silver sulfadiazine topical) SSD AF (silver sulfadiazine topical) Thermazene (silver sulfadiazine topical) thimerosal topical
Brands : Xiaflex Company : Advance Biofactures Corp Description : XIAFLEX contains purified collagenase clostridium histolyticum, consisting of two microbial collagenases in a defined mass ratio, Collagenase AUX-I and Collagenase AUX-II, which are isolated and purified from the fermentation of Clostridium histolyticum bacteria. Collagenase AUX-I is a single polypeptide chain consisting of approximately 1000 amino acids of known sequence. It has an observed molecular weight of 114 kilo. Daltons (k. Da). It belongs to the class I Clostridium histolyticum collagenases. Collagenase AUX-II is a single polypeptide chain consisting of approximately 1000 amino acids of deduced sequence. It has an observed molecular weight of 113 k. Da. It belongs to the class II Clostridium histolyticum collagenases. Used For/Prescribed for : XIAFLEX is indicated for the treatment of adult patients with Dupuytren's contracture with a palpable cord. XIAFLEX is also indicated for the treatment of adult men with Peyronie's disease with a palpable plaque and curvature deformity of at least 30 degrees at the start of therapy.
Formulation : XIAFLEX is available in single-use, glass vials containing 0. 9 mg of collagenase clostridium histolyticum. Each vial also contains 0. 5 mg of hydrochloric acid, 18. 5 mg of sucrose, and 1. 1 mg of tromethamine. Form : sterile lyophilized powder (white cake) and must be reconstituted with the provided diluent prior to use. Route of administration : intralesional injection Dosage : The dose of XIAFLEX is 0. 58 mg per injection into a palpable cord with a contracture of a metacarpophalangeal (MP) joint or a proximal interphalangeal (PIP) joint. Contraindication : XIAFLEX is contraindicated in: the treatment of Peyronie's plaques that involve the penile urethra due to potential risk to this structure. patients with a history of hypersensitivity to XIAFLEX or to collagenase used in any otherapeutic application or application method Side effects : Common Xiaflex side effects may include: swelling, bruising, or bleeding where the medicine was injected; mild pain or tenderness in the treated hand; swollen glands in your elbow or underarm; itching, redness, or warmth of the skin; cracked skin; or underarm pain.
Genral References # Norris DB, Trudgill PW: Multiple forms of cyclohexanone oxygenase from Nocardia globerula CL 1. Eur J Biochem. 1976 Mar 16; 63(1): 193 -8. "Pubmed": http: //www. ncbi. nlm. nih. gov/pubmed/4312 # Pajot P: Fluroescence of proteins in 6 -M guanidine hydrochloride. A method for the quantitative determination of tryptophan. Eur J Biochem. 1976 Mar 16; 63(1): 263 -9. "Pubmed": http: //www. ncbi. nlm. nih. gov/pubmed/4317
Refrence : http: //www. santyl. com/ http: //www. drugs. com/cdi/santyl-ointment. html http: //www. rxlist. com/santyl-drug. htm https: //www. xiaflex. com/ http: //www. drugs. com/xiaflex. html http: //www. rxlist. com/xiaflex-drug. htm
- Slides: 11