Characterization of protein folding determinants for LIN12NotchRepeats LNRs

- Slides: 1
Characterization of protein folding determinants for LIN-12/Notch-Repeats (LNRs) using Human Notch 1 LNR-B as a model system Sharline Madera Advisor: Dr. Didem Vardar-Ulu Wellesley College, Massachusetts NSF REU Chemistry Leadership Group Travel Award Recipient NSF Award CHE-0754512 LNR Domain A B C HD Domain Metal Specificity 5 Constructs Disulfide Connectivity Human Notch 1 is a member of a conserved family of heterodimeric type 1 transmembrane receptors that control differentiation in multicellular animals. Notch proteins possess three contiguous LIN-12/Notch. Repeats (LNRs), LNRA, LNRB and LNRC, in their extracellular domain that maintain the receptor in its resting conformation in the absence of ligand. These conserved LNRs display a characteristic disulfide bonding pattern and require Ca 2+ for folding. In the receptor, they are separated by two linkers, linker_AB and linker_BC, 10 and 6 amino acids long, respectively. Previously, we had shown that LNRB folding was affected by residues 6 -10 of linker_AB and not of linker_BC (1, Figure 5). In this study we investigated the dependence of LNRB folding on the identity of the metal ion as well as the number of conserved disulfide bonds. Our results indicate that LNRB folding is selective for Ca 2+ and the linker_AB length requirement and total number of disulfide bonds needed for effective folding are interdependent. Together these studies represents the initial steps toward defining the minimum requirements for a correctly folding LNR module using LNRB from human Notch 1 as a model system. linker_AB C C SLNFNDPWKN linker_BC C C QRAEGQ C C 1: 5 LNRB_orig: Mut 1, 5 C→A LNRB_orig: LNRB_short: LNRB_del. AB: LNRB_del. BC: Mut 1, 5 C→A LNRB_del. BC: LNRB_int: Mut 1, 5 C→A LNRB_int: 2: 4 3: 6 LNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQ LNFNDPWKNATQSLQCWKYFSDGHCDSQCNSAGALFDGFDCQRAEGQ DPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQ DPWKNATQSLQCWKYFSDGHCDSQCNSAGALFDGFDCQ Figure 4. Sequence Alignment for LNRB Constructs used for the study: Red Residues: Ca 2+ coordinating residues Blue Residues: Mutated cysteines to alanines Orange Residues: Disulfide bonded cysteines Mg. Cl 2 Figure 7. Chromatograms of LNRB_orig and LNRB_int folded under varying metal ion conditions. Panel A: Superposition of chromatograms of LNRB_orig folded in the presence of 10 m. M Ca. Cl 2 -red and 10 m. M Mg. Cl 2 -black. Panel B: Superposition of chromatograms of LNRB_orig folded in the presence of 1 m. M Ca. Cl 2 -green and 1 m. M Zn. Cl 2 -blue. These chromatograms demonstrate the selectivity of LNRB_orig folding for Ca 2+ which result in a single folded peak, compared to other potential divalent cations Mg 2+ and Zn 2+, which yield an array of multiple peaks indicating the lack of one predominant native fold. Table 1. Summary of HPLC & Mass Spectrometry Results LNRB_orig LNRB_int Post DTT LNRB_del. BC LNRB_del. AB LNRB_short B A Figure 5. Chromatograms of LNRB constructs: LNRB_orig- green, LNRB_int- purple, LNRB_del. BC- blue. LNRB_del. ABbrown, LNRB_short- orange Panel A) Superposition of the chromatograms of the three LNRB constructs that folded into a single predominant peak indicating a single thermodynamically favored correctly folded species. Small neighboring peaks are indicative of misfolded species. Top left inset: Representative chromatogram detailing the elution gradient used and the pressure during the run. Panel B) Superposition of the chromatograms of the two unfolded constructs after dialysis 3. Note no predominant peak is obtained demonstrating no preference for correctly folded species for these two constructs. Top right insets for both panels: Superposition of chromatograms for the same constructs after DTT treatment showing that all peaks of the folded chromatograms collapse to a single peak when reduced and elute later in the gradient (see Table 1). Mutant LNRB_del. BC Figure 3. Crystal structure of Human Notch 2 NRR (15). Figure 6. Superposition of chromatograms for LNRB_del. BC-black and Mutant LNRB_del. BC-red. Similar to LNRB_del. BC, mutant LNRB_del. BC displays a single predominant peak. This finding demonstrates that the mutant LNRB_del. BC that contains only two disulfide bonds is capable of folding into a single thermodynamically favored state whose stability is comparable to that of wild type LNRB_del. BC. • Wildtype h. N 1 LNRB was expressed as inclusion bodies in BL 21(DE 3)Plys. S E. coli. cell line as a fusion protein with a modified form of the trp. LE sequence using the p. MML vector (kind gift of S. Blacklow, BWH). • The plasmids for the mutant h. N 1 LNRBs were obtained from the corresponding wildtype p. MML vector using the Quik. Change Site-Directed Mutagenesis protocol (Stratagene) where cysteines 1 and 5 were changed into alanines eliminating the potential for the first disulfide bond. • LNRB was cleaved from the hydrophobic leader sequence by cyanogen bromide cleavage in 70% formic acid and was separated from the leader sequence through precipitation of the leader sequence upon p. H increase. • Protein identity for each construct was confirmed by Mass Spectrometry. • Soluble LNRB constructs (~175 M) were folded for two days in a refolding buffer with daily buffer changes. Ø 100 m. M Na. Cl Ø 20 m. M Tris p. H 8 Ø 10 m. M Ca. Cl 2/ 10 m. M Mg. Cl 2/ 1 m. M Zn. Cl 2 Ø 2. 5 m. M cysteine Ø 0. 5 m. M cystine A B LNRB_orig Mutant LNRB_orig • A sample of each folded construct was also incubated with 100 m. M DTT at room temp for 2 hrs and analyzed by RP-HPLC. Construct % Buffer B Elution 100 m. M DTT Correctly Folded Calculated MW (Da) Mass Spec MW (Da) LNRB_orig 28 30 Yes 5368. 8 5365. 65 Mut LNRB_orig 28. 2 -30. 2 --- No 5304. 7 --- LNRB_short 21 -25 26 No 3940. 3 3937. 54 LNRB_int 25 27 Yes 4338. 7 4291. 93 Mut LNRB_int 22. 7 -32. 3 --- No 4274. 6 4227. 36 LNRB_del. AB 23 -25 25 No 4481. 8 4480. 47 LNRB_del. BC 27 30 Yes 4827. 2 4823. 22 Mut LNRB_del. BC 26. 4 --- Yes 4763. 1 4760. 86 In this study we investigated the relative importance of the number of potential disulfide bonds and the divalent ion identity for the independent folding of LNRB in relation to the presence or absence of the linker regions flanking LNRB. Previous folding studies identified constructs LNRB_del. BC, LNRB_orig and LNRB_int as autonomously folding constructs. In this study we show two of the modified LNRB constructs where cysteines 1 and 5 are mutated to alanines to eliminate the potential of the first disulfide bond, Mut 1, 5 C→A LNRB_int and Mut 1, 5 C→A LNRB_orig, are unable to fold into a single thermodynamically favored folded state. In contrast, Mut 1, 5 C→A LNRB_del. BC retains the ability to fold autonomously. These data show that for the formation of a single thermodynamically favored LNRB species upon in vitro refolding there is a minimum requirement for the total number of stabilizing interactions that participate in the folding process. The relative impact of each of these interactions, which involve linker_AB, the disulfide bonds, and the Ca 2+ ion, in ensuring autonomous folding are highly interdependent. Furthermore the attainment of one thermodynamically favored species in the folding of LNRB is dependent and selective for Ca 2+ compared to the two other divalent cations abundant in cells, Mg 2+ and Zn 2+. The findings of this study are the initial steps in defining the minimum requirements for an autonomously folding LNR module using LNR_B as a model from human Notch 1. They will be followed by studies that include further investigations on the effects of altering the cysteine arrangement of other LNR modules with varying lengths and direct correlation of these findings to h. N 4 LNRA, a wild type LNR module within the human Notch 4 receptor and contains only two disulfide bonds. LNRB_int Mutant LNRB_int • On day 3 the constructs were moved into a dialysis buffer that did not contain any redox reagent (cysteine/cystine). • All constructs from day 3 of dialysis were analyzed on a reverse phase HPLC using a C 18 column and 0. 25%/min gradient elution under the following experimental conditions: Buffer A: 10% Acetonitrile, 90% H 2 O, 0. 1% TFA Buffer B: 90% Acetonitrile, 10% H 2 O, 0. 1% TFA Ca. Cl 2 KNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQ LNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQ LNFNDPWKNATQSLQCWKYFSDGHCDSQCNSAGALFDGFDCQ LNRB_del. BC Figure 2. Domain organization of the Notch Receptor. B Zn. Cl 2 LNRA LNRC LNRB Figure 1. Human Notch 1 LNRs and linkers. Notch Proteins are large Ca 2+ binding, transmembrane receptors that control differentiation in multicellular animals. In mammals, there are four Notch homologs: Notch 1 -4. These proteins function via a highly conserved mechanism referred to as the Notch signaling pathway, which is important for cell-cell communication, involving gene regulation mechanisms that control multiple cell differentiation processes during embryonic and adult life. Deregulation of normal Notch activation has been noted in certain human leukemias, (2) Alagille (3, 4) and CADASIL (5) syndromes, indicating that perturbations of Notch signaling underlie several forms of human diseases (6). Notch proteins exhibit a highly conserved modular architecture (Figure 2), in which distinct repeated structural units are associated with different functional roles in the intact receptor (7). Ligand binding to the N-terminal EGF-repeats activates these proteins by facilitating a proteolytic cleavage by a metalloprotease at site S 2, and triggers the gamma-secretase cleavage that permits the translocation of intracellular Notch (ICN) into the nucleus to activate the transcription of target genes (8, 9, 10, 11). The Negative Regulatory Region (NRR) of all Notch receptors has three tandem, independently folding LIN-12/Notch Repeats (LNRs) that wrap around the HD domain containing the regulatory cleavage site S 2, and mask the S 2 site in the resting receptor (Figure 3) (12 -14). Hence the interactions between the LNRs and the HD are critical in stabilizing the NRR and preventing activation prior to ligand binding. Each of the LNRs contains six cysteines with a unique disulfide bonding pattern and coordinate a single Ca 2+ (Figure 3), however the minimum requirements that would ensure an LNR to fold independently are not known. This work utilizes different LNRB constructs that all contain the 32 amino acid stretch from cysteine 1 to cysteine 6 in the second LNR of h. N 1 and various numbers of the residues that flank these residues (Table 1), to define the minimum length requirement for h. N 1 LNRB and to investigate the impact of metal ions and number of disulfide bonds on its autonomous folding. Ca. Cl 2 A Figure 7. Panel A) Superposition of the chromatograms of LNRB_orig-black and Mutant LNRB_orig-red. Panel B) Superposition of the chromatograms of LNRB_int-black and Mutant LNRB_int-red. Unlike the wild type constructs LNRB_orig and LNRB_int, mutant LNRB_orig and mutant LNRB_int do not display a single peak that corresponds to one thermodynamically stable folded state. Instead the chromatograms of the mutant constructs show various peaks indicating the presence of several thermodynamically similar species and not one favored folded state. 1. Madera, S. and Vardar-Ulu D. “Characterization of protein folding determinants for LIN-12/Notch-Repeats (LNRs) using Human Notch 1 LNR-B as a model system” Poster Presentation, 21 st Annual Symposium of the American Protein Society, Boston July 2007. 2. Ellisen, L. W. et al. (1991) Cell. 66: 649– 661. 3. Li, L. , et al. (1997) Nat. Genet. 16: 243– 251. 4. Oda, T. et al. (1997) Nat. Genet. 16: 235– 242. 5. Joutel, A. et al. (1996) Nature. 383: 707– 710. 6. Rand, M. et al. (2000) Molec. and Cell. Biol. 20: 1825 -1835. 7. Vardar, D. et al. (2003) Biochemistry. 42: 7061 -7067. 8. Sanchez-Irizarry, C. et al. (2004) Molec. and Cell. Biol. 24: 9265 -9273. 9. Logeat, F. et al. (1998) Proc. Natl. Acad. Sci. USA. 95: 8108 -8112. 10. Brou, C. et al. (2000) Mol. Cell. 2: 207 -216. 11. Lawrence, N. (2000) Development. 127: 3185 -3195. 12. Aster, J. et al. (1999) Biochemistry. 38: 4736 -4742. 13. Weng, A. P. et al. (2004) Science. 306: 269– 271. 14. Kopan, R. et al. (2000) Genes Dev. 14: 2799 -2806. 15. Gordon, W. R. et al. (2007) Nature Structural and Molec. Biol. 14: 295 -300.