Blinatumomab Drugbank ID DB 09052 Description Blinatumomab is

Blinatumomab Drugbank ID : DB 09052

Description : Blinatumomab is a Bi. TE-class (bi-specific T-cell engagers) constructed monoclonal antibody indicated for the treatment of Philadelphia chromosome-negative relapsed or refractory B-cell precursor acute lymphoblastic leukemia (ALL). Blinatumomab is manufactured by Amgen Inc. and marketed under the brand Blincyto™. A full treatment regimen consisting of two cycles of four weeks each, is priced at $178 000 USD. Blinatumomab was approved in December 2014 under the FDA’s accelerated approval program, which allows approval of a drug to treat a serious or life-threatening disease based on clinical data showing the drug has an effect on a surrogate endpoint reasonably likely to predict clinical benefit to patients.

Indication : Indicated for the treatment of Philadelphia chromosome-negative relapsed or refractory B-cell precursor acute lymphoblastic leukemia (ALL). Pharmacodynamics : Pharmacodynamic response is characterized by T-cell activation and initial redistribution, reduction in peripheral B cells, and transient cytokine elevation. Peripheral T cell redistribution (ie, T cell adhesion to blood vessel endothelium and/or transmigration into tissue) occurrs after start of BLINCYTO infusion or dose escalation. T cell counts initially declines within 1 to 2 days and then returnes to baseline levels within 7 to 14 days in majority patients.

Mechanism of action : Blinatumomab is a bispecific CD 19 -directed CD 3 T-cell engager that binds to CD 19 expressed on the surface of cells of B-lineage origin and CD 3 expressed on the surface of T cells. It activates endogenous T cells by connecting CD 3 in the T-cell receptor (TCR) complex with CD 19 on benign and malignant B cells. Blinatumomab mediates the formation of a synapse between the T cell and the tumor cell, upregulation of cell adhesion molecules, production of cytolytic proteins, release of inflammatory cytokines, and proliferation of T cells, which result in redirected lysis of CD 19+ cells.

Targets : B-lymphocyte antigen CD 19 T-cell surface glycoprotein CD 3 delta chain Affected organisms : Humans and other mammals Categories : Antibodies, Monoclonal Antineoplastic Agents Antineoplastic and Immunomodulating Agents Chemical Actions and Uses Immunosuppressive Agents Myelosuppressive Agents Pharmacologic Actions Therapeutic Uses

Sequence : >single chain variable fragment fusion protein DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKLLIYDASN LVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPWTFGGGTKLEIKGGG GSGGGGSQVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQ GLEWIGQIWPGDGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARR ETTTVGRYYYAMDYWGQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKTS GYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAY MQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGG VDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVA SGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELKHHHH HH

Brands : Blincyto Company : Amgen Canada Inc Description : BLINCYTO (blinatumomab) is a bispecific CD 19 -directed CD 3 T-cell engager that binds to CD 19 (expressed on cells of B-lineage origin) and CD 3 (expressed on T cells). BLINCYTO is produced in Chinese hamster ovary cells. It consists of 504 amino acids. Used for/Prescribed for : BLINCYTO is indicated for the treatment of Philadelphia chromosome-negative relapsed or refractory B-cell precursor acute lymphoblastic leukemia (ALL). Formulation : 12. 5 mcg/m. L Form : lyophilized powder for intravenous administration Route of administration : intravenous

Contraindication : BLINCYTO is contraindicated in patients with known hypersensitivity to blinatumomab or to any component of the product formulation. Side effects : Cytokine Release Syndrome; Neurological Toxicities; Infections; Tumor Lysis Syndrome; Neutropenia and Febrile Neutropenia; Effects on Ability to Drive and Use Machines; Elevated Liver Enzymes; Leukoencephalopathy; Preparation and Administration Errors. Drug interaction : The risk or severity of adverse effects can be increased when Blinatumomab is combined with Clozapine; The risk or severity of adverse effects can be increased when Denosumab is combined with Blinatumomab; The risk or severity of adverse effects can be increased when Blinatumomab is combined with Leflunomide; The risk or severity of adverse effects can be increased when Metamizole is combined with Blinatumomab; The risk or severity of adverse effects can be increased when Blinatumomab is combined with Natalizumab; The risk or severity of adverse effects can be increased when Pimecrolimus is combined with Blinatumomab; Roflumilast may increase the immunosuppressive activities of Blinatumomab; The therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Blinatumomab; The risk or severity of adverse effects can be increased when Tacrolimus is combined with Blinatumomab; Blinatumomab may increase the immunosuppressive activities of Tofacitinib

References : http: //www. drugbank. ca/drugs/DB 09052 http: //www. rxlist. com/blincyto-drug/clinical-pharmacology. htm